GIP (1 - 30), porcine, amide

SKU: orb2694010

Description

GIP (1-30) amide, porcine is a full glucose-dependent insulinotropic polypeptide (GIP) receptor agonist with high affinity equal to native GIP(1-42). GIP (1-30) amide, porcine is a weak inhibitor of gastric acid secretion and potent stimulator of insulin.

Images & Validation

−

Key Properties

−

Target	Insulin Receptor
CAS Number	134846-93-8
MW	3551.07
Purity	≥95%
Formula	C₁₆₂H₂₄₅N₄₁O₄₇S
Protein Sequence	YAEGTFISDYSIAMDKIRQQDFVNWLLAQK-NH2

Storage & Handling

−

Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

Insulin Receptor

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols