You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Target | GCK |
| Protein Sequence | Synthetic peptide located within the following region: RVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTAEMLFDYISECISDFL |
| Molecular Weight | 51kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−GLK Rabbit Polyclonal Antibody [orb13428]
FC, ICC, WB
Canine, Equine, Gallus, Mouse, Porcine, Rabbit
Human, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 50 μlGerminal Center Kinase (GCK/MAP4K2) Antibody (Center) [orb1929594]
IHC-P, WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Lanes: 1: 50 ug HEP3B lysate, 2: 50 ug HEP3B lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:1000, Gene Name: GCK.

WB Suggested Anti-GCK Antibody, Titration: 1.0 ug/ml, Positive Control: COLO205 Whole Cell.
Documents Download
Request a Document
GCK Rabbit Polyclonal Antibody (orb585036)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review













