GCK Rabbit Polyclonal Antibody

• Catalog Number: orb585036
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GCK
• Target: GCK
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Sequence: Synthetic peptide located within the following region: RVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTAEMLFDYISECISDFL
• UniProt ID: P35557
• MW: 51kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: GK, GLK, HK4, HHF3, HKIV, HXKP, LGLK, MODY2, PNDM1
• Note: For research use only
• NCBI: NP_277043

Lanes: 1: 50 ug HEP3B lysate, 2: 50 ug HEP3B lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:1000, Gene Name: GCK.

WB Suggested Anti-GCK Antibody, Titration: 1.0 ug/ml, Positive Control: COLO205 Whole Cell.