GBA Rabbit Polyclonal Antibody

• Catalog Number: orb584987
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GBA
• Target: GBA
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Sequence: Synthetic peptide located within the following region: EGSQRVGLVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVG
• UniProt ID: P04062
• MW: 59kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: GCB, GBA1, GLUC
• Note: For research use only
• NCBI: NP_000148

Positive control (+): Human liver (LI), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/ml.

WB Suggested Anti-GBA Antibody Primary: 1:1000, Positive Control: rat organs, fibroblasts, HeLa cell lysate.

WB Suggested Anti-GBA Antibody Titration: 1 ug/ml, Positive Control: MDA-MB-435S cell lysate. GBA is strongly supported by BioGPS gene expression data to be expressed in Human MDA-MB435 cells.