You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579583 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GATD3A |
Target | GATD3A |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Rat, Sheep, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf33 |
Protein Sequence | Synthetic peptide located within the following region: SRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDL |
UniProt ID | P30042 |
MW | 21kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | ES1, HES1, KNPH, KNPI, GATD3, GT335, C21orf33 |
Note | For research use only |
NCBI | NP_937798 |
Human Muscle
WB Suggested Antibody Titration: 2.5 ug/ml, Positive Control: HepG2. C21orf33 is supported by BioGPS gene expression data to be expressed in HepG2.
FC, IF, IHC-Fr, IHC-P, WB | |
Canine, Gallus, Mouse, Porcine | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Equine, Guinea pig, Human, Mouse, Rat, Sheep, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |
IHC, WB | |
Bovine, Equine, Guinea pig, Human, Mouse, Rat, Sheep, Zebrafish | |
Rabbit | |
Polyclonal | |
FITC |
IHC, WB | |
Bovine, Equine, Guinea pig, Human, Mouse, Rat, Sheep, Zebrafish | |
Rabbit | |
Polyclonal | |
Biotin |