GATD3A Rabbit Polyclonal Antibody

• Catalog Number: orb579583
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GATD3A
• Target: GATD3A
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rat, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf33
• Protein Sequence: Synthetic peptide located within the following region: SRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDL
• UniProt ID: P30042
• MW: 21kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ES1, HES1, KNPH, KNPI, GATD3, GT335, C21orf33
• Research Area: Cell Biology, Immunology & Inflammation, Signal Tr
• Note: For research use only
• NCBI: NP_937798
• Expiration Date: 12 months from date of receipt.

Human Muscle

WB Suggested Antibody Titration: 2.5 ug/ml, Positive Control: HepG2. C21orf33 is supported by BioGPS gene expression data to be expressed in HepG2.