Gastric Inhibitory Polypeptide (1-30) (porcine)

SKU: orb2693945

Description

Gastric Inhibitory Polypeptide (1-30), porcine lacks the C-terminal 12 amino acid residues of natural gastric inhibitory polypeptide (GIP), exhibits biologic activity by potentiating the release of insulin and somatostatin.

Research Area

Gastroenterology & Hepatology

Images & Validation

−

Key Properties

−

Target	Insulin Receptor
CAS Number	134875-67-5
MW	3552.1
Purity	≥95%
Formula	C₁₆₂H₂₄₄N₄₀O₄₈S
Protein Sequence	YAEGTFISDYSIAMDKIRQQDFVNWLLAQK

Storage & Handling

−

Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

Insulin Receptor

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide