Gallus TNFSF15 protein

• Catalog Number: orb1215708
• Category: Proteins
• Description: The Chicken TNFSF15 (TL1A; VEGI) Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken TNFSF15 (TL1A; VEGI) Biotinylated applications are for cell culture. Chicken TNFSF15 (TL1A; VEGI) Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Chicken TNFSF15 (TL1A; VEGI) Biotinylated Specifications: (Molecular Weight: 19.1 kDa) (Amino Acid Sequence: ERSSHFLKQRAVAAVTDTLPSAEKPRAHLTVKKQEPSSTTGSHLPILQWEDKRGLAFTKNNLSYSSNALVIPVSGDYYVYAQVTFRGPSDTSSKTSSVTAVITKVTDSYPEPTQLLTSTKTLSEERNNWFQPIYLGAVVSLEIGDKLMVNVSDIKLVDYTKEHKTFFGAFLL) (Gene ID: 417247).
• Target: TNFSF15
• Form/Appearance: Lyophilized
• Purity: 98%
• Protein Sequence: ERSSHFLKQRAVAAVTDTLPSAEKPRAHLTVKKQEPSSTTGSHLPILQWEDKRGLAFTKNNLSYSSNALVIPVSGDYYVYAQVTFRGPSDTSSKTSSVTAVITKVTDSYPEPTQLLTSTKTLSEERNNWFQPIYLGAVVSLEIGDKLMVNVSDIKLVDYTKEHKTFFGAFLL
• Protein Length: 172
• MW: 19.1 kDa
• Source: Yeast
• Biological Origin: Chicken
• Storage: -20°C
• Alternative names: TL1A
• Note: For research use only