You have no items in your shopping cart.
Galanin Message Associated Peptide (1-41), amide; GMAP (1-41), amide; Preprogalanin (65-105), amide
SKU: orb2694022
Description
Research Area
Neuroscience
Images & Validation
−
Key Properties
−| Target | others |
|---|---|
| CAS Number | 132699-74-2 |
| MW | 4643.3 |
| Purity | ≥95% |
| Formula | C206H326N56O64S |
| Protein Sequence | ELEPEDEARPGGFDRLQSEDKAIRTIMEFLAFLHLKEAGAL-NH2 |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
others
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Galanin Message Associated Peptide (1-41), amide; GMAP (1-41), amide; Preprogalanin (65-105), amide (orb2694022)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review