GABPA Rabbit Polyclonal Antibody

• Catalog Number: orb592897
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GABPA
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GABPA
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 51kDa
• Target: GABPA
• UniProt ID: Q06546
• Protein Sequence: Synthetic peptide located within the following region: KWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIG
• NCBI: NP_002031
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: NFT2, NRF2, NRF2A, E4TF1A, E4TF1-60, RCH04A07
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.

Human kidney

WB Suggested Anti-GABPA Antibody Titration: 0.5-1.0 ug/ml, Positive Control: Jurkat cell lysate. GABPA is supported by BioGPS gene expression data to be expressed in Jurkat.