You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592897 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GABPA |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human GABPA |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 51kDa |
Target | GABPA |
UniProt ID | Q06546 |
Protein Sequence | Synthetic peptide located within the following region: KWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIG |
NCBI | NP_002031 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | NFT2, NRF2, NRF2A, E4TF1A, E4TF1-60, RCH04A07 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.
Human kidney
WB Suggested Anti-GABPA Antibody Titration: 0.5-1.0 ug/ml, Positive Control: Jurkat cell lysate. GABPA is supported by BioGPS gene expression data to be expressed in Jurkat.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Gallus, Mouse, Porcine, Rabbit, Sheep | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Biotin |