Gabpa Rabbit Polyclonal Antibody

• Catalog Number: orb573735
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Gabpa
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Gabpa
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 51kDa
• Target: Gabpa
• UniProt ID: Q00422
• Protein Sequence: Synthetic peptide located within the following region: MTKREAEELIEIEIDGTEKAECTEESIVEQTYTPAECVSQAIDINEPIGN
• NCBI: NP_032091
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: GAB, GABPalpha
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Mouse Lung lysates, Antibody dilution: 1.0 ug/ml.

Rabbit Anti-GABPA antibody, Formalin Fixed Paraffin Embedded Tissue: Human Breast, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-GABPA Antibody, Catalog Number: orb573735, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-Gabpa antibody Titration: 1 ug/ml, Sample Type: Human heart.

WB Suggested Anti-Gabpa antibody Titration: 1 ug/ml, Sample Type: Human liver.