You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573735 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Gabpa |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Gabpa |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 51kDa |
Target | Gabpa |
UniProt ID | Q00422 |
Protein Sequence | Synthetic peptide located within the following region: MTKREAEELIEIEIDGTEKAECTEESIVEQTYTPAECVSQAIDINEPIGN |
NCBI | NP_032091 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | GAB, GABPalpha Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: Mouse Lung lysates, Antibody dilution: 1.0 ug/ml.
Rabbit Anti-GABPA antibody, Formalin Fixed Paraffin Embedded Tissue: Human Breast, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-GABPA Antibody, Catalog Number: orb573735, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-Gabpa antibody Titration: 1 ug/ml, Sample Type: Human heart.
WB Suggested Anti-Gabpa antibody Titration: 1 ug/ml, Sample Type: Human liver.
ELISA, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Gallus, Mouse, Porcine, Rabbit, Sheep | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Biotin |