FZD4 Rabbit Polyclonal Antibody

• Catalog Number: orb324947
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GPCR
• Target: FZD4
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human FZD4
• Protein Sequence: Synthetic peptide located within the following region: LDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNLQKDGTKTDKLERL
• UniProt ID: Q9ULV1
• MW: 47kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Fz4, EVR1, FEVR, Fz-4, FzE4, GPCR, hFz4, CD344, FZ
• Note: For research use only
• NCBI: NP_036325.2

Sample Type: COLO205 Whole cell lysates, Antibody Dilution: 1.0 ug/mL.