FZD4 Rabbit Polyclonal Antibody

• Catalog Number: orb330168
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FZD4
• Target: FZD4
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FZD4
• Protein Sequence: Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV
• UniProt ID: Q9ULV1
• MW: 60 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti EVR1 antibody, anti FEVR antibody, anti FZD4S
• Note: For research use only
• NCBI: NP_036325

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Sample Tissue: Human Lung Tumor, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human RPMI 8226 Whole Cell, Antibody Dilution: 3 ug/mL.

Positive control (+): Human lung (LU), Negative control (-): 293T (2T), Antibody concentration: 1 ug/mL.

Skin

WB Suggested Anti-FZD4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Fetal Liver.