You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330168 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FZD4 |
Target | FZD4 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FZD4 |
Protein Sequence | Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV |
UniProt ID | Q9ULV1 |
MW | 60 kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti EVR1 antibody, anti FEVR antibody, anti FZD4S Read more... |
Note | For research use only |
NCBI | NP_036325 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.
Sample Tissue: Human Lung Tumor, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human RPMI 8226 Whole Cell, Antibody Dilution: 3 ug/mL.
Positive control (+): Human lung (LU), Negative control (-): 293T (2T), Antibody concentration: 1 ug/mL.
Skin
WB Suggested Anti-FZD4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Fetal Liver.
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Gallus, Human, Porcine, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |