FZD10 Rabbit Polyclonal Antibody

• Catalog Number: orb577978
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FZD10
• Target: FZD10
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH
• Protein Sequence: Synthetic peptide located within the following region: GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH
• UniProt ID: Q9ULW2
• MW: 65 kDa
• Tested applications: IF
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Fz10, FzE7, CD350, FZ-10, hFz10
• Note: For research use only
• NCBI: NP_009128

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml.

orb577978 FZD10 Antibody, Sample type: COS7 cells mock transfected, Primary Ab dilution: 1:333, Secondary Ab: anti-rabbit-Cy2, Secondary Ab dilution: 1:500, Blue: DAPI, Green:FZD10.

orb577978 FZD10 Antibody, Sample type: COS7 cells transfected with chick FZD10, Primary Ab dilution: 1:333, Secondary Ab: anti-rabbit-Cy2, Secondary Ab dilution: 1:500, Blue: DAPI, Green:FZD10.