FXYD5 Rabbit Polyclonal Antibody

• Catalog Number: orb329934
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FXYD5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Mouse, Yeast
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FXYD5
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 20kDa
• Target: FXYD5
• UniProt ID: Q96DB9
• Protein Sequence: Synthetic peptide located within the following region: LQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDD
• NCBI: NP_659003
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti RIC antibody, anti IWU1 antibody, anti KCT1 a
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: Lane 1: 10 ug hFXYD5 transfected 293T lysate, Lane 2: 10 ug 293T lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:4000, Gene Name: FXYD5.

WB Suggested Anti-FXYD5 Antibody Titration: 0.625 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Placenta.