You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329820 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FXYD5 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FXYD5 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 19kDa |
Target | FXYD5 |
UniProt ID | Q96DB9 |
Protein Sequence | Synthetic peptide located within the following region: SERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLRKRGLLVAAVLFITG |
NCBI | NP_054883 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti HSPC113 antibody, anti IWU-1 antibody, anti I Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-FXYD5 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human heart.