FUNDC1 Rabbit Polyclonal Antibody

• Catalog Number: orb582015
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FUNDC1
• Target: FUNDC1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FUNDC1
• Protein Sequence: Synthetic peptide located within the following region: MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSV
• UniProt ID: Q8IVP5
• MW: 17 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MGC51029
• Research Area: Autophagic, Cancer, Epigenetics, Neuroscience, Sig
• Note: For research use only
• NCBI: NP_776155

25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

FUNDC1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb582015 with 1:200 dilution. Western blot was performed using orb582015 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: FUNDC1 IP with orb582015 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

Positive control (+): Stomach tumor (T-ST), Negative control (-): Human lung (LU), Antibody concentration: 3 ug/ml.

WB Suggested Anti-FUNDC1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human heart.