FUNDC1 Rabbit Polyclonal Antibody

SKU: orb582015

Description

Rabbit polyclonal antibody to FUNDC1

Research Area

Autophagic, Cancer, Epigenetics, Neuroscience, Signaling Pathways

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FUNDC1
• Target: FUNDC1
• Protein Sequence: Synthetic peptide located within the following region: MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSV
• Molecular Weight: 17 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

MGC51029

25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

FUNDC1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb582015 with 1:200 dilution. Western blot was performed using orb582015 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: FUNDC1 IP with orb582015 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

Positive control (+): Stomach tumor (T-ST), Negative control (-): Human lung (LU), Antibody concentration: 3 ug/ml.

WB Suggested Anti-FUNDC1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human heart.

Quick Database Links

Gene Symbol

FUNDC1

UniProt

Q8IVP5

RefSeq (Protein):NP_776155