You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb582015 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to FUNDC1 |
| Target | FUNDC1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FUNDC1 |
| Protein Sequence | Synthetic peptide located within the following region: MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSV |
| UniProt ID | Q8IVP5 |
| MW | 17 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | MGC51029 |
| Research Area | Autophagic, Cancer, Epigenetics, Neuroscience, Sig Read more... |
| Note | For research use only |
| NCBI | NP_776155 |

25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

FUNDC1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb582015 with 1:200 dilution. Western blot was performed using orb582015 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: FUNDC1 IP with orb582015 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

Positive control (+): Stomach tumor (T-ST), Negative control (-): Human lung (LU), Antibody concentration: 3 ug/ml.

WB Suggested Anti-FUNDC1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human heart.
WB | |
Human, Rat | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review