Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

SKU: orb1981596

Description

This product is a synthetic derivative of the Exendin-4 peptide, with the sequence FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS. It is utilized in research applications, including in vitro and in vivo studies, to investigate mechanisms related to glucose metabolism and GLP-1 receptor signaling.

Research Area

Pharmacology & Drug Discovery

Images & Validation

Key Properties

TargetGlucagon Receptor
MW3692.15
Formula3692.15

Storage & Handling

Storage-20°C
Expiration Date12 months from date of receipt.
DisclaimerFor research use only
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide