You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574362 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FOXP3 |
Target | FOXP3 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FOXP3 |
Protein Sequence | Synthetic peptide located within the following region: PHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGL |
UniProt ID | Q9BZS1 |
MW | 47kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | JM2, AIID, IPEX, PIDX, XPID, DIETER |
Note | For research use only |
NCBI | NP_054728 |
Sample Type: Mouse Spleen frozen with positive lymphocytes / HPF (x400), Primary dilution: 1:100, Secondary Antibody: Vector Lab Goat Biotin-Conjugated Anti-Rabbit IgG, Secondary dilution: 1:100.
Sample Tissue: Human NCI-H226, Antibody dilution: 1.0 ug/ml.
Human Liver
WB Suggested Anti-FOXP3 Antibody Titration: 5.0-8.0 ug/ml, Positive Control: HepG2 cell lysate.
FC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF | |
Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
PE |
FC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Mouse, Porcine, Rat | |
Polyclonal | |
Unconjugated |