You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb574362 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to FOXP3 |
| Target | FOXP3 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FOXP3 |
| Protein Sequence | Synthetic peptide located within the following region: PHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGL |
| UniProt ID | Q9BZS1 |
| MW | 47kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | JM2, AIID, IPEX, PIDX, XPID, DIETER |
| Research Area | Epigenetics & Chromatin, Immunology & Inflammation Read more... |
| Note | For research use only |
| NCBI | NP_054728 |
| Expiration Date | 12 months from date of receipt. |

Sample Type: Mouse Spleen frozen with positive lymphocytes / HPF (x400), Primary dilution: 1:100, Secondary Antibody: Vector Lab Goat Biotin-Conjugated Anti-Rabbit IgG, Secondary dilution: 1:100.

Sample Tissue: Human NCI-H226, Antibody dilution: 1.0 ug/ml.

Human Liver

WB Suggested Anti-FOXP3 Antibody Titration: 5.0-8.0 ug/ml, Positive Control: HepG2 cell lysate.
FC | |
Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC | |
Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
PE |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Mouse, Porcine, Rat | |
Polyclonal | |
Unconjugated |
FC | |
Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
FITC |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review