You have no items in your shopping cart.
FOXK2 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FOXK2 |
| Target | FOXK2 |
| Protein Sequence | Synthetic peptide located within the following region: ANTYTVSGQAVVTPAAVLAPPKAEAQENGDHREVKVKVEPIPAIGHATLG |
| Molecular Weight | 69kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−FOXK2 Rabbit Polyclonal Antibody [orb577407]
WB
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish
Human
Rabbit
Polyclonal
Unconjugated
100 μlFOXK2 Rabbit Polyclonal Antibody [orb575260]
WB
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish
Human
Rabbit
Polyclonal
Unconjugated
100 μlFOXK2 Rabbit Polyclonal Antibody [orb592873]
WB
Equine, Mouse, Rabbit, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. FOXK2 is supported by BioGPS gene expression data to be expressed in 721_B.

Rabbit Anti-FOXK2 Antibody, Catalog Number: orb575259, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Nuclear in perinuclear/nuclear Membrane, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-FOXK2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate, FOXK2 is supported by BioGPS gene expression data to be expressed in HepG2.
Documents Download
Request a Document
Protocol Information
FOXK2 Rabbit Polyclonal Antibody (orb575259)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review








