FOXG1B Rabbit Polyclonal Antibody

• Catalog Number: orb324763
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FOXG1
• Target: FOXG1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FOXG1B
• Protein Sequence: Synthetic peptide located within the following region: STSMSARATSSSTSPQAPSTLPCESLRPSLPSFTTGLSGGLSDYFTHQNQ
• UniProt ID: Q86XT7
• MW: 52kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti BF1 antibody, anti BF2 antibody, anti QIN ant
• Research Area: Epigenetics & Chromatin, Neuroscience, Stem Cell &
• Note: For research use only
• NCBI: NP_005240
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-FOXG1B Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:312500, Positive Control: Transfected 293T.