You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576131 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FOXD1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Rat |
Reactivity | Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse FOXD1 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 46 kDa |
Target | FOXD1 |
UniProt ID | Q61345 |
Protein Sequence | Synthetic peptide located within the following region: TGAGTGGGAKNPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISSRFP |
NCBI | NP_032268 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | BF-2, FREA, Hfh10, FREAC4, Hfhbf2, AI385632 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein may be modified by glycosylation.
WB Suggested Anti-FOXD1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: SP2/0 cell lysate.
ELISA, ICC, IF, IHC-Fr, IHC-P, WB | |
Canine, Gallus, Human, Mouse, Rabbit, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-P, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Porcine, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |