FOXD1 Rabbit Polyclonal Antibody

• Catalog Number: orb576131
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FOXD1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Rat
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse FOXD1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 46 kDa
• Target: FOXD1
• UniProt ID: Q61345
• Protein Sequence: Synthetic peptide located within the following region: TGAGTGGGAKNPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISSRFP
• NCBI: NP_032268
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: BF-2, FREA, Hfh10, FREAC4, Hfhbf2, AI385632
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein may be modified by glycosylation.

WB Suggested Anti-FOXD1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: SP2/0 cell lysate.