Cart summary

You have no items in your shopping cart.

FLJ20489 Rabbit Polyclonal Antibody (Biotin)

FLJ20489 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2122078

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2122078
CategoryAntibodies
DescriptionFLJ20489 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human FLJ20489
Protein SequenceSynthetic peptide located within the following region: LISGDSPASAFQSAGIIGVSHRARPGSVFLARSEESLYLRPGQQSQEVKV
UniProt IDQ9NX17
MW26kDa
Tested applicationsIHC, WB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesHRG1, HRG-1, hHRG-1
NoteFor research use only
NCBINP_060312