Cart summary

You have no items in your shopping cart.

FLJ20489 Rabbit Polyclonal Antibody (FITC)

FLJ20489 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2122077

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2122077
CategoryAntibodies
DescriptionFLJ20489 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human FLJ20489
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW26kDa
UniProt IDQ9NX17
Protein SequenceSynthetic peptide located within the following region: LISGDSPASAFQSAGIIGVSHRARPGSVFLARSEESLYLRPGQQSQEVKV
NCBINP_060312
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesHRG1, HRG-1, hHRG-1
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.