Fish CHRNA1 protein

SKU: orb418714

Description

This Fish CHRNA1 protein spans the amino acid sequence from region 25-234aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Neuroscience

Images & Validation

• Application Notes:
  Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 25-234aaSequence Info: Extracellular Domain

Key Properties

• Source: E.coli
• Biological Origin: Tetronarce californica (Pacific electric ray) (Torpedo californica)
• Tag: N-terminal 6xHis-SUMO-tagged
• Molecular Weight: 40.8 kDa
• Expression Region: 25-234aa
• Protein Length: Partial
• Protein Sequence: SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI
• Purity: Greater than 90% as determined by SDS-PAGE.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CHRNA1Acetylcholine receptor subunit alpha

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Tetronarce californica (Pacific electric ray) (Torpedo californica) CHRNA1.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Tetronarce californica (Pacific electric ray) (Torpedo californica) CHRNA1.

Quick Database Links

UniProt

P02710