You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb575057 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to FHL1 |
| Target | FHL1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human FHL1 |
| Protein Sequence | Synthetic peptide located within the following region: YYCVDCYKNFVAKKCAGCKNPITGFGKGSSVVAYEGQSWHDYCFHCKKCS |
| UniProt ID | Q6IB30 |
| MW | 32kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | KYOT, SLIM, FCMSU, FHL-1, FHL1A, FHL1B, FLH1A, SLI Read more... |
| Research Area | Epigenetics & Chromatin, Signal Transduction, Stem Read more... |
| Note | For research use only |
| NCBI | NP_001440 |

Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.

Sample Type: Human Fetal Heart, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Positive control (+): Human heart muscle, Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.

Human kidney

WB Suggested Anti-FHL1 Antibody Titration: 0.1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Muscle.
WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Human, Porcine, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Biotin |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review