FHL1 Rabbit Polyclonal Antibody

• Catalog Number: orb573951
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FHL1
• Target: FHL1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Human
• Protein Sequence: Synthetic peptide located within the following region: SKEVHYKNRFWHDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDSPK
• UniProt ID: Q6IB30
• MW: 32kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: KYOT, SLIM, FCMSU, FHL-1, FHL1A, FHL1B, FLH1A, SLI
• Research Area: Epigenetics & Chromatin, Molecular Biology, Stem C
• Note: For research use only
• NCBI: NP_001440

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-FHL1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human brain.