FGR Rabbit Polyclonal Antibody

SKU: orb330758

Description

FGR Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of FGR. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human FGR. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FGR
• Target: FGR
• Protein Sequence: Synthetic peptide located within the following region: CPPGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQ
• Molecular Weight: 59kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti FLJ43153 antibody, anti MGC75096 antibody, anti SRC2 antibody, anti c-fgr antibody, anti c-src2 antibody, anti p55c-fgr antibody, anti p58c-fgr antibody, anti p55-Fgr antibody, anti p58-Fgr antibody

Quick Database Links

Gene Symbol

FGR

UniProt

P09769

RefSeq (Protein):NP_001036194