Cart summary

You have no items in your shopping cart.

FGR Rabbit Polyclonal Antibody

SKU: orb330758

Description

Rabbit polyclonal antibody to FGR

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human FGR
TargetFGR
Protein SequenceSynthetic peptide located within the following region: CPPGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQ
Molecular Weight59kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti FLJ43153 antibody, anti MGC75096 antibody, anti SRC2 antibody, anti c-fgr antibody, anti c-src2 antibody, anti p55c-fgr antibody, anti p58c-fgr antibody, anti p55-Fgr antibody, anti p58-Fgr antibody

Similar Products

  • Phospho-FGFR1 (Tyr307) Rabbit Polyclonal Antibody [orb5240]

    ELISA,  IF,  IHC-Fr,  IHC-P

    Bovine, Equine, Gallus, Guinea pig, Mouse, Porcine

    Human, Rabbit, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-FLG (Tyr766) Rabbit Polyclonal Antibody [orb6031]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl
  • Phospho-FGFR1+FGFR2 (Tyr463/Tyr466) Rabbit Polyclonal Antibody [orb5241]

    ELISA,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • FGFR1 Rabbit Polyclonal Antibody [orb10655]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Gallus

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-FGFR1 (Tyr653 + Tyr654) Rabbit Polyclonal Antibody [orb5238]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

FGR Rabbit Polyclonal Antibody

Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.

FGR Rabbit Polyclonal Antibody

WB Suggested Anti-FGR Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: U937 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

FGR Rabbit Polyclonal Antibody (orb330758)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry