FGL2 Rabbit Polyclonal Antibody

• Catalog Number: orb581627
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FGL2
• Target: FGL2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FGL2
• Protein Sequence: Synthetic peptide located within the following region: WTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMIL
• UniProt ID: Q14314
• MW: 50 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: T49, pT49
• Note: For research use only
• NCBI: NP_006673

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. 50 kDa protein is processed to 46 kDa and the protein contains several potential glycosylation sites.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Protein may be subject to glycosylation.

WB Suggested Anti-FGL2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Placenta.