You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb586175 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FFAR2 |
Target | FFAR2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Canine |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: RRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE |
UniProt ID | O15552 |
MW | 37 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | FFA2R, GPR43 |
Note | For research use only |
NCBI | NP_005297 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Protein is glycosylated resulting in multiple bands.
Sample Tissue: Human Stomach Tumor, Antibody dilution: 1.0 ug/ml.
Positive control (+): Human liver (LI), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.
WB Suggested Anti-FFAR2 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Liver.
ICC, IF, IHC-Fr, IHC-P | |
Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |