FEN1 Rabbit Polyclonal Antibody

• Catalog Number: orb579666
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FEN1
• Target: FEN1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Sequence: Synthetic peptide located within the following region: APSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSH
• UniProt ID: P39748
• MW: 42kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MF1, RAD2, FEN-1
• Note: For research use only
• NCBI: NP_004102

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

WB Suggested Anti-FEN1 Antibody, Positive Control: Lane 1: hFEN1 (1-336), Lane 2: uninduced BL21, Lane 3: 2h induced BL21, Lane 4: overnight induced BL21, Primary Antibody Dilution: 1:2000, Secondary Antibody: Goat anti-rabbit-HRP, Secondry Antibody Dilution: 1:10000.

WB Suggested Anti-FEN1 Antibody, Titration: 1.0 ug/ml, Positive Control: 293T Whole Cell. FEN1 is supported by BioGPS gene expression data to be expressed in HEK293T.