Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

F2 Rabbit Polyclonal Antibody

SKU: orb578202

Description

Rabbit polyclonal antibody to F2

Research Area

Cell Biology, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human F2
TargetF2
Protein SequenceSynthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE
Molecular Weight70 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

PT, THPH1, RPRGL2

Similar Products

  • MYH1 Rabbit Polyclonal Antibody [orb2563457]

    IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Prothrombin rabbit pAb Antibody [orb766731]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
  • PTGFRN Rabbit Polyclonal Antibody [orb556498]

    ICC,  IHC-P,  WB

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • CD315 rabbit pAb Antibody [orb767242]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • F2 Rabbit Polyclonal Antibody [orb10521]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

F2 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Protein is processed to prothrombin and the peptide also is contained in the b-chain form of ~30 kDa as well as a 32 kDa form of prothrombin. Peptide aligns to amino acids 419-432 kDa in the full length form.

F2 Rabbit Polyclonal Antibody

Anti-F2 / Thrombin antibody IHC staining of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

F2 Rabbit Polyclonal Antibody

Anti-F2 / Thrombin antibody IHC staining of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

F2 Rabbit Polyclonal Antibody

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml.

F2 Rabbit Polyclonal Antibody

Positive control (+): HepG2 (HG), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.

F2 Rabbit Polyclonal Antibody

Rabbit Anti-F2 Antibody, Paraffin Embedded Tissue: Human Placenta, Antibody Concentration: 5 ug/ml.

F2 Rabbit Polyclonal Antibody

WB Suggested Anti-F2 Antibody, Titration: 1 ug/ml, Positive Control: 721_B cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000497

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

F2 Rabbit Polyclonal Antibody (orb578202)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry