F2 Rabbit Polyclonal Antibody

• Catalog Number: orb578202
• Category: Antibodies
• Description: Rabbit polyclonal antibody to F2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Sheep, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human F2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 70 kDa
• Target: F2
• UniProt ID: P00734
• Protein Sequence: Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE
• NCBI: NP_000497
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PT, THPH1, RPRGL2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Protein is processed to prothrombin and the peptide also is contained in the b-chain form of ~30 kDa as well as a 32 kDa form of prothrombin. Peptide aligns to amino acids 419-432 kDa in the full length form.

Anti-F2 / Thrombin antibody IHC staining of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Anti-F2 / Thrombin antibody IHC staining of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml.

Positive control (+): HepG2 (HG), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.

Rabbit Anti-F2 Antibody, Paraffin Embedded Tissue: Human Placenta, Antibody Concentration: 5 ug/ml.

WB Suggested Anti-F2 Antibody, Titration: 1 ug/ml, Positive Control: 721_B cell lysate.