ETS2 Rabbit Polyclonal Antibody

• Catalog Number: orb576754
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ETS2
• Target: ETS2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ETS2
• Protein Sequence: Synthetic peptide located within the following region: DPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVC
• UniProt ID: P15036
• MW: 53kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ETS2IT1
• Research Area: Epigenetics & Chromatin, Molecular Biology, Signal
• Note: For research use only
• NCBI: NP_005230

ETS2 antibody - middle region (orb576754) validated by WB using human LCL and mouse brains at 1:1000.

Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/ml.

Positive control (+): Mouse Kidney (M-KI), Negative control (-): Mouse Testis (M-TE), Antibody concentration: 1 ug/ml.

WB Suggested Anti-ETS2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human kidney.