You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574066 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ERCC8 |
Target | ERCC8 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ERCC8 |
Protein Sequence | Synthetic peptide located within the following region: DVERIHGGGINTLDIEPVEGRYMLSGGSDGVIVLYDLENSSRQSYYTCKA |
UniProt ID | Q13216 |
MW | 44kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | CSA, CKN1, UVSS2 |
Note | For research use only |
NCBI | NP_000073 |
Rabbit Anti-ERCC8 Antibody, Catalog Number: orb574066, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic, Nuclear, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-ERCC8 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human muscle.
WB Suggested Anti-ERCC8 antibody Titration: 1 ug/ml, Sample Type: Human liver.
IHC, WB | |
Canine, Equine, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Equine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FA, ICC, PLA, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |