You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb573839 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to ERCC8 |
| Target | ERCC8 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Canine, Equine, Porcine, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ERCC8 |
| Protein Sequence | Synthetic peptide located within the following region: QELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG |
| UniProt ID | Q13216 |
| MW | 44kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | CSA, CKN1, UVSS2 |
| Research Area | Epigenetics & Chromatin, Molecular Biology |
| Note | For research use only |
| NCBI | NP_000073 |

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Type: Human HepG2, Antibody dilution: 1.0 ug/ml. ERCC8 is supported by BioGPS gene expression data to be expressed in HepG2.

Sample Type: MCF7 Whole Cell lysates, Antibody dilution: 1.0 ug/ml.

Human Liver

Human Muscle

WB Suggested Anti-ERCC8 Antibody Titration: 0.1-5.0 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.

WB Suggested Anti-ERCC8 antibody Titration: 1 ug/ml, Sample Type: Human liver.
IF, IHC-Fr, IHC-P, WB | |
Equine, Human | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FA, ICC, PLA, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review