Equine IL-8 protein

• Catalog Number: orb1216278
• Category: Proteins
• Description: The Equine IL-8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-8 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-8 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-8 Specifications: (Molecular Weight: 8.9 kDa) (Amino Acid Sequence: AVVSRITAELRCQCIKTHSKPFNPKLIKEMRVIESGPHCENSEIIVKLVNGAEVCLNPHTKWVQIIVQAFLKRAEGQNP (79)) (Gene ID: 100037400).
• Target: IL-8
• Form/Appearance: Lyophilized
• Purity: 98%
• Protein Sequence: AVVSRITAELRCQCIKTHSKPFNPKLIKEMRVIESGPHCENSEIIVKLVNGAEVCLNPHTKWVQIIVQAFLKRAEGQNP (79)
• Protein Length: 79
• MW: 8.9 kDa
• Source: Yeast
• Biological Origin: Equine
• Storage: -20°C
• Alternative names: CXCL8
• Note: For research use only