You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329999 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to EOMES |
Target | EOMES |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human EOMES |
Protein Sequence | Synthetic peptide located within the following region: YTSACKRRRLSPSNSSNENSPSIKCEDINAEEYSKDTSKGMGGYYAFYTT |
UniProt ID | O95936 |
MW | 73kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti TBR2 antibody |
Note | For research use only |
NCBI | NP_005433 |
Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 3 ug/mL.
WB Suggested Anti-EOMES Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: NCI-H226 cell lysate.
FC, IF, IHC-Fr, IHC-P | |
Bovine, Equine, Gallus, Mouse, Sheep | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Guinea pig, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P | |
Bovine, Equine, Gallus, Mouse, Sheep | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |