Eomes Rabbit Polyclonal Antibody

SKU: orb329904

Description

Rabbit polyclonal antibody to Eomes

Research Area

Immunology & Inflammation

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Guinea pig, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human Eomes
• Target: Eomes
• Protein Sequence: Synthetic peptide located within the following region: SSDSGVYNSACKRKRLSPSTPSNGNSPPIKCEDINTEEYSKDTSKGMGAY
• Molecular Weight: 75kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti C77258 antibody, anti Tbr2 antibody, anti TBR-2 antibody

Immunohistochemistry with Placenta tissue at an antibody concentration of Dilution: 1:200 using anti-Eomes antibody (orb329904).

WB Suggested Anti-Eomes Antibody Titration: 0.2-1 ug/mL, Positive Control: Mouse Muscle.

Quick Database Links

Gene Symbol

Eomes

UniProt

O54839

RefSeq (Protein):NP_034266