Eomes Rabbit Polyclonal Antibody

• Catalog Number: orb329904
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Eomes
• Target: Eomes
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Guinea pig, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human Eomes
• Protein Sequence: Synthetic peptide located within the following region: SSDSGVYNSACKRKRLSPSTPSNGNSPPIKCEDINTEEYSKDTSKGMGAY
• UniProt ID: O54839
• MW: 75kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti C77258 antibody, anti Tbr2 antibody, anti TBR
• Note: For research use only
• NCBI: NP_034266

Immunohistochemistry with Placenta tissue at an antibody concentration of Dilution: 1:200 using anti-Eomes antibody (orb329904).

WB Suggested Anti-Eomes Antibody Titration: 0.2-1 ug/mL, Positive Control: Mouse Muscle.