ENO3 Rabbit Polyclonal Antibody

• Catalog Number: orb580332
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ENO3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ENO3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47kDa
• Target: ENO3
• UniProt ID: P13929
• Protein Sequence: Synthetic peptide located within the following region: EVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLKAVENIN
• NCBI: NP_001967
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MSE, GSD13
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-ENO3 Antibody, Catalog Number: orb580332, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-ENO3 Antibody Titration: 0.25 ug/ml, Positive Control: Jurkat cell lysate.

WB Suggested Anti-ENO3 antibody Titration: 1 ug/ml, Sample Type: Human heart.

WB Suggested Anti-ENO3 antibody Titration: 1 ug/ml, Sample Type: Human liver.