You have no items in your shopping cart.
Description
Images & Validation
−
Key Properties
−| Target | Opioid Receptor |
|---|---|
| CAS Number | 59887-17-1 |
| MW | 3466.09 |
| Purity | ≥95% |
| Formula | C157H254N42O44S |
| Protein Sequence | YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |
Similar Products
−[DPro5] Corticotropin Releasing Factor, human, rat [orb2694799]
≥95%
4757.45
250 mg, 25 mg, 10 mg, 5 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
Opioid Receptor
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
β-Endorphin, rat (orb2694662)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review