β-Endorphin, rat

SKU: orb2694662

Description

β-Endorphin (rat) is an endogenous opioid neuropeptide and peptide hormone. β-Endorphin (rat) has analgesic activity and also contributes to food intake in satiated rats. β-Endorphin (rat) can be used in the research of neurological diseases such as analgesia and drug addiction.

Images & Validation

−

Key Properties

−

Target	Opioid Receptor
CAS Number	59887-17-1
MW	3466.09
Purity	≥95%
Formula	C₁₅₇H₂₅₄N₄₂O₄₄S
Protein Sequence	YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ

Storage & Handling

−

Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

Opioid Receptor

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols

Purity:	≥95%
CAS Number:	77367-63-6
MW:	3466.09
Formula:	C₁₅₇H₂₅₄N₄₂O₄₄S

Purity:	≥95%
MW:	4757.45

β-Endorphin, rat

Description

Images & Validation

Key Properties

Storage & Handling

Similar Products

β-Endorphin, rat [orb321535]

[DPro5] Corticotropin Releasing Factor, human, rat [orb1981083]

β-Endorphin (rat) [orb1985161]

β-Endorphin, rat [orb1944070]

[DPro5] Corticotropin Releasing Factor, human, rat [orb2694799]

Quality Guarantee

Quick Database Links

Protocol Information

Available Sizes

Email

UK Office

US Office

CN Office

Distributors