EN2 Rabbit Polyclonal Antibody

• Catalog Number: orb329598
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EN2
• Target: EN2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human EN2
• Protein Sequence: Synthetic peptide located within the following region: NESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE
• UniProt ID: P19622
• MW: 34kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Research Area: Epigenetics & Chromatin, Neuroscience, Stem Cell &
• Note: For research use only
• NCBI: NP_001418

Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/mL.

Positive control (+): 293T (2T), Negative control (-): Ovary tumor (T-OV), Antibody concentration: 3 ug/mL.

Human Kidney

Rabbit Anti-EN2 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-EN2 Antibody Titration: 0.05 ug/mL, ELISA Titer: 1:2500, Positive Control: Human cerebellum.