You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582075 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to EIF5 |
Target | EIF5 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human EIF5 |
Protein Sequence | Synthetic peptide located within the following region: SVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPT |
UniProt ID | P55010 |
MW | 49kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | EIF-5, EIF-5A |
Research Area | Epigenetics & Chromatin |
Note | For research use only |
NCBI | NP_892116 |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.
Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.
Sample Type: Hela, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that EIF5 is expressed in HeLa.
WB Suggested Anti-EIF5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Hela cell lysate. There is BioGPS gene expression data showing that EIF5 is expressed in HeLa.
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Equine, Human, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Sheep, Yeast | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |