You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576553 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Eif5 |
Target | Eif5 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Mouse, Rat |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Sheep, Yeast |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Protein Sequence | Synthetic peptide located within the following region: VKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKTASVPKVETVKSDNK |
UniProt ID | Q07205 |
MW | 47kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Research Area | Epigenetics |
Note | For research use only |
NCBI | NP_064460 |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Mouse Kidney, Antibody Dilution: 1 ug/ml.
WB Suggested Anti-Eif5 Antibody, Titration: 1.0 ug/ml, Positive Control: Rat Lung.
WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Equine, Human, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |