You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326514 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to EIF3I |
Target | EIF3I |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: RDPSQIDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKS |
UniProt ID | Q13347 |
MW | 36kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti EIF3S2 antibody, anti PRO2242 antibody, anti Read more... |
Note | For research use only |
NCBI | NP_003748 |
Sample Type: Human Hela, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.0 ug/mL, Peptide Concentration: 2.0 ug/mL, Lysate Quantity: 25 ug/lane.
WB Suggested Anti-EIF3I Antibody, Titration: 1.0 ug/mL, Positive Control: Hela Whole Cell, EIF3I is supported by BioGPS gene expression data to be expressed in HeLa.
IHC, IP, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Mouse, Porcine, Rabbit | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P, WB | |
Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |