EIF3I Rabbit Polyclonal Antibody

• Catalog Number: orb326514
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EIF3I
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 36kDa
• Target: EIF3I
• UniProt ID: Q13347
• Protein Sequence: Synthetic peptide located within the following region: RDPSQIDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKS
• NCBI: NP_003748
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti EIF3S2 antibody, anti PRO2242 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Hela, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.0 ug/mL, Peptide Concentration: 2.0 ug/mL, Lysate Quantity: 25 ug/lane.

WB Suggested Anti-EIF3I Antibody, Titration: 1.0 ug/mL, Positive Control: Hela Whole Cell, EIF3I is supported by BioGPS gene expression data to be expressed in HeLa.