You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb326513 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to EIF3I |
| Target | EIF3I |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse, Rat |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Protein Sequence | Synthetic peptide located within the following region: NVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTFRTERPV |
| UniProt ID | Q13347 |
| MW | 36kDa |
| Tested applications | IHC, IP, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti EIF3S2 antibody, anti PRO2242 antibody, anti Read more... |
| Research Area | Cell Biology, Epigenetics & Chromatin |
| Note | For research use only |
| NCBI | NP_003748 |

EIF3I antibody - C-terminal region (orb326513) validated by WB using HepG2 cell lysate at 1.0 ug/mL.

Sample Type: Human 293T, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.0 ug/mL, Peptide Concentration: 2.0 ug/mL, Lysate Quantity: 25 ug/lane.

Sample Type: Human 293T, Antibody Dilution: 1.0 ug/mL.

Sample Type: 3. rat brain extract (80 ug), Primary antibody Dilution: 2 ug/mL, Secondary antibody: IRDye 800CW goat anti-rabbit, Secondary antibody Dilution: 1:20000.

Sample Type: Mouse brain stem cells, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: EIF3I: Red DAPI:Blue, Gene Name: EIF3I.
ELISA, FC, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Mouse, Porcine, Rabbit | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P, WB | |
Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Canine, Mouse, Porcine, Rabbit | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Cy5.5 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review