EIF3I antibody

• Catalog Number: orb326513
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EIF3I
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, IP, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 36kDa
• Target: EIF3I
• UniProt ID: Q13347
• Protein Sequence: Synthetic peptide located within the following region: NVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTFRTERPV
• NCBI: NP_003748
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti EIF3S2 antibody, anti PRO2242 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human 293T tissue using EIF3I antibody

Western blot analysis of human 293T tissue using EIF3I antibody

Immunohistochemical staining of mouse brain tissue using EIF3I antibody

Western blot analysis of rat brain tissue using EIF3I antibody

Western blot analysis of human HepG2 tissue using EIF3I antibody