EIF3E Rabbit Polyclonal Antibody

• Catalog Number: orb330533
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EIF3E
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EIF3E
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 52kDa
• Target: EIF3E
• UniProt ID: P60228
• Protein Sequence: Synthetic peptide located within the following region: LNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTK
• NCBI: NP_001559
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti EIF3-P48 antibody, anti EIF3S6 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Rabbit Anti-EIF3E Antibody, Catalog Number: orb330533, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Sample Type: 1. B8 mouse fibroblast cells, extraction only2. Human total cell extractPrimary dilution: 1:1000, Secondary Anitbody: HRP conjugated anti-rabbit.

WB Suggested Anti-EIF3E Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.