EIF3E Rabbit Polyclonal Antibody

• Catalog Number: orb330532
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EIF3E
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EIF3E
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 52kDa
• Target: EIF3E
• UniProt ID: P60228
• Protein Sequence: Synthetic peptide located within the following region: ELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQ
• NCBI: NP_001559
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti EIF3-P48 antibody, anti EIF3S6 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

EIF3E antibody - N-terminal region (orb330532) validated by WB using B8 mouse cells and HEK293 human cells at 1:1000.

Kidney

WB Suggested Anti-EIF3E Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate, EIF3E is supported by BioGPS gene expression data to be expressed in HEK293T.