EIF2B5 Rabbit Polyclonal Antibody

• Catalog Number: orb584990
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EIF2B5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Rat
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 80 kDa
• Target: EIF2B5
• UniProt ID: Q13144
• Protein Sequence: Synthetic peptide located within the following region: GVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPI
• NCBI: NP_003898
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CLE, CACH, LVWM, EIF-2B, EIF2Bepsilon
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.

WB Suggested Anti-EIF2B5 Antibody, Titration: 1.0 ug/ml, Positive Control: U937 Whole Cell.