You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb578459 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to EIF2AK1 |
| Target | EIF2AK1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human EIF2AK1 |
| Protein Sequence | Synthetic peptide located within the following region: TCSDEFSSLRLHHNRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALE |
| UniProt ID | Q9BQI3 |
| MW | 71 kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | HCR, HRI, hHRI, LEMSPAD |
| Research Area | Infectious Disease & Virology |
| Note | For research use only |
| NCBI | NP_055228 |

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Two isoforms at 71 kDa contain the peptide sequence and the protein is phosphorylated.

Sample Type: Human 293T, Antibody Dilution: 1.0 ug/ml. EIF2AK1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.

Sample Type: Human Hela, Antibody Dilution: 1.0 ug/ml. EIF2AK1 is strongly supported by BioGPS gene expression data to be expressed in HeLa.

Positive control (+): Hela (HL), Negative control (-): Human brain (BR), Antibody concentration: 1 ug/ml.

WB Suggested Anti-EIF2AK1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Lung.
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Mouse, Rat | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P, WB | |
Mouse | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF, IHC-Fr, IHC-P, WB | |
Mouse | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Human, Mouse | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review