EIF2AK1 Rabbit Polyclonal Antibody

SKU: orb578459

Description

Rabbit polyclonal antibody to EIF2AK1

Research Area

Infectious Disease & Virology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EIF2AK1
• Target: EIF2AK1
• Protein Sequence: Synthetic peptide located within the following region: TCSDEFSSLRLHHNRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALE
• Molecular Weight: 71 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

HCR, HRI, hHRI, LEMSPAD

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Two isoforms at 71 kDa contain the peptide sequence and the protein is phosphorylated.

Sample Type: Human 293T, Antibody Dilution: 1.0 ug/ml. EIF2AK1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.

Sample Type: Human Hela, Antibody Dilution: 1.0 ug/ml. EIF2AK1 is strongly supported by BioGPS gene expression data to be expressed in HeLa.

Positive control (+): Hela (HL), Negative control (-): Human brain (BR), Antibody concentration: 1 ug/ml.

WB Suggested Anti-EIF2AK1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Lung.

Quick Database Links

Gene Symbol

EIF2AK1

UniProt

Q9BQI3

RefSeq (Protein):NP_055228