EIF2AK1 Rabbit Polyclonal Antibody

• Catalog Number: orb578459
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EIF2AK1
• Target: EIF2AK1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EIF2AK1
• Protein Sequence: Synthetic peptide located within the following region: TCSDEFSSLRLHHNRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALE
• UniProt ID: Q9BQI3
• MW: 71 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: HCR, HRI, hHRI, LEMSPAD
• Research Area: Infectious Disease & Virology
• Note: For research use only
• NCBI: NP_055228

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Two isoforms at 71 kDa contain the peptide sequence and the protein is phosphorylated.

Sample Type: Human 293T, Antibody Dilution: 1.0 ug/ml. EIF2AK1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.

Sample Type: Human Hela, Antibody Dilution: 1.0 ug/ml. EIF2AK1 is strongly supported by BioGPS gene expression data to be expressed in HeLa.

Positive control (+): Hela (HL), Negative control (-): Human brain (BR), Antibody concentration: 1 ug/ml.

WB Suggested Anti-EIF2AK1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Lung.