Egr1 Rabbit Polyclonal Antibody

• Catalog Number: orb576117
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Egr1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Sheep
• Reactivity: Frog, Mouse
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 56kDa
• Target: Egr1
• UniProt ID: P08046
• Protein Sequence: Synthetic peptide located within the following region: PATTSFPSPVPTSYSSPGSSTYPSPAHSGFPSPSVATTFASVPPAFPTQV
• NCBI: NP_031939
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: NG, TI, NGF, Zen, egr, Egr-, Krox, NGF1, TIS8, Zen
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Frog brain, Primary Antibody Dilution: 1:500, Secondary Antibody: Biotinylated goat anti-rabbit, Secondary Antibody Dilution: 1:200, Color/Signal Descriptions: Black: EGR1, Gene Name: Egr1 a.

Sample Type: Frog brain, Primary Antibody Dilution: 1:500, Secondary Antibody: Biotinylated goat anti-rabbit, Secondary Antibody Dilution: 1:200, Color/Signal Descriptions: Black: EGR1, Gene Name: Egr1 a.

WB Suggested Anti-Egr1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Mouse Heart.