EGR1 Rabbit Polyclonal Antibody

• Catalog Number: orb574097
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EGR1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Equine, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EGR1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 58 kDa
• Target: EGR1
• UniProt ID: P18146
• Protein Sequence: Synthetic peptide located within the following region: DNYPKLEEMMLLSNGAPQFLGAAGAPEGSGSNSSSSSSGGGGGGGGGSNS
• NCBI: NP_001955
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: TIS8, AT225, G0S30, NGFI-A, ZNF225, KROX-24, ZIF-2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.

Immunohistochemistry with Colon, myenteric plexus tissue at an antibody concentration of 5.0 ug/ml using anti-EGR1 antibody (orb574097).

Rabbit Anti-EGR1 Antibody, Paraffin Embedded Tissue: Human Intestine, Cellular Data: Epithelial cells of intestinal villas, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-EGR1 Antibody, Paraffin Embedded Tissue: Human Spleen, Cellular Data: Spleen cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-EGR1 Antibody Titration: 1 ug/ml, Positive Control: Jurkat cell lysate.