EGFR Rabbit Polyclonal Antibody

• Catalog Number: orb584868
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EGFR
• Target: EGFR
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: VTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLS
• UniProt ID: P00533
• MW: 69kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ERBB, ERRP, HER1, mENA, ERBB1, PIG61, NISBD2
• Research Area: Cancer Biology, Cell Biology, Epigenetics & Chroma
• Note: For research use only
• NCBI: NP_958439
• Expiration Date: 12 months from date of receipt.

Lanes: Lane 1: 4 ug DRM fraction from MDA-MB-231, Primary Antibody dilution: 1:1000, Secondary Antibody: Donkey anti-rabbit IgG-HRP, Secondary Antibody dilution: 1:10000, Gene Name: EGFR. EGFR is strongly supported by BioGPS gene expression data to be expressed in Human MDA-MB231 cells.

Rabbit Anti-EGFR Antibody, Catalog Number: orb584868, Formalin Fixed Paraffin Embedded Tissue: Human Thyroid Gland Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-EGFR Antibody, Titration: 1.0 ug/ml, Positive Control: Placenta.